PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.MY1RF
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 124aa    MW: 13956.4 Da    PI: 6.0107
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.MY1RFgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.34.1e-2972121251
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                  prlrWtp+LH rF++av++LGG+e+AtPk +l+lm++kgL+++hvkSHLQ
  Araip.MY1RF  72 PRLRWTPDLHLRFLHAVQRLGGQERATPKLVLQLMNIKGLSIAHVKSHLQ 121
                  8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2568121IPR009057Homeodomain-like
PROSITE profilePS5129410.55968124IPR017930Myb domain
SuperFamilySSF466892.87E-1372122IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-2172122IPR006447Myb domain, plants
PfamPF002494.7E-973121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MEESHGSQCS KTSPSNLEEE EEEEEEDDDE CENKKNNGGG GGGCSSNSTV EENSNNNNDK  60
KKIRPYVRSK FPRLRWTPDL HLRFLHAVQR LGGQERATPK LVLQLMNIKG LSIAHVKSHL  120
QVIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016186617.11e-83PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A0B2P2N21e-52A0A0B2P2N2_GLYSO; Putative Myb family transcription factor
TrEMBLK7K3F71e-52K7K3F7_SOYBN; Uncharacterized protein
STRINGGLYMA01G31044.14e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-34G2-like family protein